PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_26740
Common NameKK1_030281
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 333aa    MW: 37684.2 Da    PI: 6.2847
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_26740genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.9e-162572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
    C.cajan_26740 25 KGLWSPEEDEKLIRYMITKGQGCWSDIARNAGLQRCGKSCRLRWINYL 72
                     678*******************************************97 PP

2Myb_DNA-binding52.51.1e-1678122147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++++E+el+++++  lG++ W+ Ia++++ gRt++++k++w++ 
    C.cajan_26740  78 RGAFSPQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 122
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.42072IPR017930Myb domain
SuperFamilySSF466891.91E-2823119IPR009057Homeodomain-like
SMARTSM007175.4E-132474IPR001005SANT/Myb domain
PfamPF002492.8E-142572IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.1E-232679IPR009057Homeodomain-like
CDDcd001671.47E-112872No hitNo description
PROSITE profilePS5129426.12673127IPR017930Myb domain
SMARTSM007171.8E-1677125IPR001005SANT/Myb domain
PfamPF002492.8E-1578122IPR001005SANT/Myb domain
CDDcd001675.21E-1280123No hitNo description
Gene3DG3DSA:1.10.10.602.7E-2680127IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MRKPDMMGKD NKMNNNNNIK SKLRKGLWSP EEDEKLIRYM ITKGQGCWSD IARNAGLQRC  60
GKSCRLRWIN YLRPDLKRGA FSPQEEELII HLHSILGNRW SQIAARLPGR TDNEIKNFWN  120
STLKKRLKIN NSTSSPNNSD SSEPRDHVMA GIMPMNNEHD LMTMCMDSSS STSSSSMHAN  180
NMVLPDQFDP FPLLSNRYDM TGAAGYLDNM ASACLTQVGM THDHDGVHGG YYGTMLEPNK  240
TGLENDFSLP PLESTSIEDN SNSTPIDVKS HNNHQFKNIS CFNNTIQSPN NVVVEDLFGF  300
ANHGQGENFR MGEWDFEGLM QDISYFPSLD FQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28231275108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358811e-134AC235881.2 Glycine max clone GM_WBc0011H22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003555035.21e-175PREDICTED: transcription factor MYB46-like
TrEMBLA0A151RZW40.0A0A151RZW4_CAJCA; Transcription factor MYB46
STRINGGLYMA19G05080.11e-175(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.13e-73myb domain protein 83